Structure of PDB 8pj5 Chain o Binding Site BS01

Receptor Information
>8pj5 Chain o (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISF
HRREDAARAIAGVSGFGYDHLILNVEW
Ligand information
>8pj5 Chain 7 (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caacaacaacaacaaggauccaaaacagaccaccaugguacguuucaagg
cuugag
..................................................
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pj5 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R267 Y269 A271 K274 K280 F282 A283 F284
Binding residue
(residue number reindexed from 1)		R30 Y32 A34 K37 K43 F45 A46 F47
External links
PDB RCSB:8pj5, PDBe:8pj5, PDBj:8pj5
PDBsum8pj5
PubMed
UniProtO75821|EIF3G_HUMAN Eukaryotic translation initiation factor 3 subunit G (Gene Name=EIF3G)

[Back to BioLiP]