Structure of PDB 8pj1 Chain o Binding Site BS01

Receptor Information
>8pj1 Chain o (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISF
HRREDAARAIAGVSGFGYDHLILNVEW
Ligand information
>8pj1 Chain 7 (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacaacaacaacaacaacaacaacaaggauccaaaacagaccaccau
...............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pj1 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining
Resolution3.4 Å
Binding residue
(original residue number in PDB)
K280 F282 F284
Binding residue
(residue number reindexed from 1)
K43 F45 F47
External links
PDB RCSB:8pj1, PDBe:8pj1, PDBj:8pj1
PDBsum8pj1
PubMed
UniProtO75821|EIF3G_HUMAN Eukaryotic translation initiation factor 3 subunit G (Gene Name=EIF3G)

[Back to BioLiP]