Structure of PDB 8euy Chain o Binding Site BS01

Receptor Information

>8euy Chain o (length=129) Species: 4896 (Schizosaccharomyces pombe)

KKKGVLYVGRLPHGFYEKQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFI
EFESLDVANVVAETMHNYLLYGKLLQCKVIPEDQVHENMFKGADVPFKRI
PHATIARLQHADKLITRHNRKLKLKKRKL

Ligand information

>8euy Chain 6 (length=56)

acaaucuucucacauguuuuuuuuuaaauauuuuugagaaaauuuguuuu
uuuuuu

...........<<..>>...............<.......>.........
......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8euy Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): Y108 R111 R135 M136 S137 R138 N139 R140 G143 S144 S145 K146 H147 Y148 F150 Y172 K174 K179 I181 Q185 N189 M190 G193 V196 F198 K199 R200 H203 A207 R208 H211
• Binding residue (residue number reindexed from 1): Y7 R10 R34 M35 S36 R37 N38 R39 G42 S43 S44 K45 H46 Y47 F49 Y71 K73 K78 I80 Q84 N88 M89 G92 V95 F97 K98 R99 H102 A106 R107 H110

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:1902626 assembly of large subunit precursor of preribosome

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus

External links

• PDB: RCSB:8euy, PDBe:8euy, PDBj:8euy
• PDBsum: 8euy
• PubMed: 36423630
• UniProt: O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c (Gene Name=SPCC1827.05c)