Structure of PDB 8eup Chain o Binding Site BS01

Receptor Information

>8eup Chain o (length=136) Species: 4896 (Schizosaccharomyces pombe)

KKGVLYVGRLPHGFYEKQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFIE
FESLDVANVVAETMHNYLLYGKLLQCKVIPEDQVHENMFKGADVPFKRIP
HATIARLQHEKPLSKEKADKLITRHNRKLKLKKRKL

Ligand information

>8eup Chain 6 (length=55)

acaaucuucucacaugagguguugaacgaaaauuuaaauuuaguuugaaa
ucgau

........<<<<..>>>>.....<<<<.<.<<<<..>>>>>.>>>>....
.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8eup Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): Y108 R111 M136 R138 N139 R140 S144 S145 K146 H147 Y148 N189 M190 V196 P197 F198 K199 R200 H203 A204 A207 Q210 H211
• Binding residue (residue number reindexed from 1): Y6 R9 M34 R36 N37 R38 S42 S43 K44 H45 Y46 N87 M88 V94 P95 F96 K97 R98 H101 A102 A105 Q108 H109

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:1902626 assembly of large subunit precursor of preribosome

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus

External links

• PDB: RCSB:8eup, PDBe:8eup, PDBj:8eup
• PDBsum: 8eup
• PubMed: 36423630
• UniProt: O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c (Gene Name=SPCC1827.05c)