Structure of PDB 8etg Chain o Binding Site BS01

Receptor Information
>8etg Chain o (length=109) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKKGVLYVGRLPHGFYEKQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFI
EFESLDVANVVAETMHNYLLYGKLLQCKVIPEDQVHENMFKGADVPFKRI
PHATIARLQ
Ligand information
>8etg Chain 6 (length=62) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaaucuucucacaugagguguugaacgaaaauauuuaguuugaaaucgg
ugaaauuuuacc
........<<<<..>>>>.....<<<<...<<..>>..>>>>........
.<<<..>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8etg Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Y108 R111 Y117 K119 R135 S144 S145 H147 Y148 F150 Y172 K174 K179 H187 M190 V196 P197 R200 H203
Binding residue
(residue number reindexed from 1)		Y7 R10 Y16 K18 R34 S43 S44 H46 Y47 F49 Y71 K73 K78 H86 M89 V95 P96 R99 H102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8etg, PDBe:8etg, PDBj:8etg
PDBsum8etg
PubMed36423630
UniProtO74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c (Gene Name=SPCC1827.05c)

[Back to BioLiP]