Structure of PDB 8esq Chain o Binding Site BS01

Receptor Information

>8esq Chain o (length=137) Species: 4896 (Schizosaccharomyces pombe)

KKKGVLYVGRLPHGFYEKQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFI
EFESLDVANVVAETMHNYLLYGKLLQCKVIPEDQVHENMFKGADVPFKRI
PHATIARLQHEKPLSKEKADKLITRHNRKLKLKKRKL

Ligand information

>8esq Chain 6 (length=81)

acaaucuucucacaugagguguugaacgaaaauuuaaauuuaguuugaaa
ucgauuggugaaaacgguuuuaccacuuugu

........<<<<..>>>>.....<<<<.<.<<<<..>>>>>.>>>>....
.......<.<<<<....>>>>..>.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8esq Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): Y108 R111 Y117 E118 K119 R135 M136 S137 R138 N139 R140 K141 S144 S145 K146 H147 Y148 Y172 K174 K179 H187 M190 K192 V196 P197 F198 K199 R200 I201 P202 H203 T205 L209 Q210 H211 K219 L223 K234
• Binding residue (residue number reindexed from 1): Y7 R10 Y16 E17 K18 R34 M35 S36 R37 N38 R39 K40 S43 S44 K45 H46 Y47 Y71 K73 K78 H86 M89 K91 V95 P96 F97 K98 R99 I100 P101 H102 T104 L108 Q109 H110 K118 L122 K133

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:1902626 assembly of large subunit precursor of preribosome

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus

External links

• PDB: RCSB:8esq, PDBe:8esq, PDBj:8esq
• PDBsum: 8esq
• PubMed: 36423630
• UniProt: O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c (Gene Name=SPCC1827.05c)