Structure of PDB 7uqz Chain o Binding Site BS01

Receptor Information

>7uqz Chain o (length=133) Species: 1247190 (Saccharomyces cerevisiae BY4741)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW

Ligand information

>7uqz Chain 6 (length=58)

ccuucucaaacauguuugguagugagugauacucgaguuaacuugaaauu
gccuuaaa

......<<<<<..>>>>>.....<<<<.<.<<<..>>>>.>>>>......
........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
• Resolution: 2.44 Å
• Binding residue (original residue number in PDB): Y94 R97 H100 R124 N125 K126 S131 R132 H133 Y134 F136 M158 H160 E174 K175 L176 I189 R207
• Binding residue (residue number reindexed from 1): Y7 R10 H13 R37 N38 K39 S44 R45 H46 Y47 F49 M71 H73 E87 K88 L89 I102 R120

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
• PDBsum: 7uqz
• PubMed: 36864048
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)