Structure of PDB 7r7a Chain o Binding Site BS01

Receptor Information

>7r7a Chain o (length=133) Species: 1247190 (Saccharomyces cerevisiae BY4741)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW

Ligand information

>7r7a Chain 6 (length=87)

ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugcuggccuuuaggcgaacaauguucuuaaa

......<<<<<<...>>>>>>.....<<<<...<<<<<..>>>>>..>>>
>..........<<<<..>>>>................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7r7a Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
• Resolution: 3.04 Å
• Binding residue (original residue number in PDB): Y94 S96 R97 H100 K105 R124 N125 K126 N130 S131 R132 H133 Y134 F136 M158 H160 L167 K172 E174 K175 L176 Y177 Y179 R182 V183 L184 K187 I189 T190 K191
• Binding residue (residue number reindexed from 1): Y7 S9 R10 H13 K18 R37 N38 K39 N43 S44 R45 H46 Y47 F49 M71 H73 L80 K85 E87 K88 L89 Y90 Y92 R95 V96 L97 K100 I102 T103 K104

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7r7a, PDBe:7r7a, PDBj:7r7a
• PDBsum: 7r7a
• PubMed: 36482249
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)