Structure of PDB 7ohx Chain o Binding Site BS01

Receptor Information

>7ohx Chain o (length=112) Species: 559292 (Saccharomyces cerevisiae S288C)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKQLKDNMK
QKHEERIKKLAK

Ligand information

>7ohx Chain 6 (length=65)

ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa

......<<<<<.....>>>>>.....<<<<...<<<<....>>>>..>>>
>..............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7ohx Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): Y94 R97 N125 K127 N130 R132 H133 Y134 F136 M158 H160 L167 A171 K172 E174 K175 K203 R207
• Binding residue (residue number reindexed from 1): Y7 R10 N38 K40 N43 R45 H46 Y47 F49 M71 H73 L80 A84 K85 E87 K88 K102 R106

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ohx, PDBe:7ohx, PDBj:7ohx
• PDBsum: 7ohx
• PubMed: 34813592
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)