Structure of PDB 7ohs Chain o Binding Site BS01

Receptor Information

>7ohs Chain o (length=133) Species: 559292 (Saccharomyces cerevisiae S288C)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW

Ligand information

>7ohs Chain 6 (length=65)

ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa

......<<<<<<...>>>>>>.....<<<<...<<<<....>>>>..>>>
>..............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7ohs Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
• Resolution: 4.38 Å
• Binding residue (original residue number in PDB): R97 H100 R124 N125 K126 K127 N130 R132 H133 Y134 F136 M158 H160 L167 A171 K172 E174 K175 G188 T190 K191 K203 R207
• Binding residue (residue number reindexed from 1): R10 H13 R37 N38 K39 K40 N43 R45 H46 Y47 F49 M71 H73 L80 A84 K85 E87 K88 G101 T103 K104 K116 R120

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ohs, PDBe:7ohs, PDBj:7ohs
• PDBsum: 7ohs
• PubMed: 34813592
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)