Structure of PDB 7o3t Chain o Binding Site BS01

Receptor Information
>7o3t Chain o (length=115) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDVPSSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFG
DSEAYAFARKGRHIFIKPQAELANTNLIVVTDRRSYKFRLQMRNDRNGAM
YELAFRYPDTQARQT
Ligand information
>7o3t Chain n (length=19) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KTPYELARERMLRSGLTAG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o3t Cryo-EM structure of a type IV secretion system.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		H67 D71 S72 E73 E91
Binding residue
(residue number reindexed from 1)		H47 D51 S52 E53 E71
Enzymatic activity
Enzyme Commision number ?
External links