Structure of PDB 7cgo Chain o Binding Site BS01

Receptor Information
>7cgo Chain o (length=109) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKK
VMVRAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQL
KGMMNVLQG
Ligand information
>7cgo Chain 9 (length=21) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cgo Structural basis of assembly and torque transmission of the bacterial flagellar motor.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		L86 Y87 V89 P90 S94 R104
Binding residue
(residue number reindexed from 1)		L59 Y60 V62 P63 S67 R77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:0071978 bacterial-type flagellum-dependent swarming motility
Cellular Component
GO:0009288 bacterial-type flagellum
GO:0009425 bacterial-type flagellum basal body
GO:0030694 bacterial-type flagellum basal body, rod

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cgo, PDBe:7cgo, PDBj:7cgo
PDBsum7cgo
PubMed33882274
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]