Structure of PDB 6em3 Chain o Binding Site BS01

Receptor Information

>6em3 Chain o (length=116) Species: 559292 (Saccharomyces cerevisiae S288C)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRKQLKD
NMKQKHEERIKKLAKS

Ligand information

>6em3 Chain 6 (length=65)

ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa

......<<<<<<...>>>>>>.....<<<<.<.<<<<<..>>>>>>.>>>
>..............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6em3 Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): E174 K175
• Binding residue (residue number reindexed from 1): E87 K88

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6em3, PDBe:6em3, PDBj:6em3
• PDBsum: 6em3
• PubMed: 29245012
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)