Structure of PDB 6cb1 Chain o Binding Site BS01

Receptor Information

>6cb1 Chain o (length=133) Species: 1247190 (Saccharomyces cerevisiae BY4741)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW

Ligand information

>6cb1 Chain 6 (length=87)

ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugcuggccuuuaggcgaacaauguucuuaaa

......<<<<<.....>>>>>.....<<<<...<<<<....>>>>..>>>
>..........<<<<..>>>>................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6cb1 Modular assembly of the nucleolar pre-60S ribosomal subunit.
• Resolution: 4.6 Å
• Binding residue (original residue number in PDB): R97 R124 N125 K126 S131 H133 M158 H160 E174 K175 V183 I189 T190
• Binding residue (residue number reindexed from 1): R10 R37 N38 K39 S44 H46 M71 H73 E87 K88 V96 I102 T103

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6cb1, PDBe:6cb1, PDBj:6cb1
• PDBsum: 6cb1
• PubMed: 29512650
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)