Structure of PDB 3jct Chain o Binding Site BS01

Receptor Information

>3jct Chain o (length=133) Species: 559292 (Saccharomyces cerevisiae S288C)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW

Ligand information

>3jct Chain 6 (length=65)

ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugccuuaaa

......<<<<<<...>>>>>>.....<<<<...<<<<....>>>>..>>>
>..............

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes
• Resolution: 3.08 Å
• Binding residue (original residue number in PDB): Y94 R97 H100 R124 N125 K126 N130 R132 H133 Y134 F136 M158 H160 E174 K175 L176 Y179 R182 I189 T190 K191 R207
• Binding residue (residue number reindexed from 1): Y7 R10 H13 R37 N38 K39 N43 R45 H46 Y47 F49 M71 H73 E87 K88 L89 Y92 R95 I102 T103 K104 R120

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jct, PDBe:3jct, PDBj:3jct
• PDBsum: 3jct
• PubMed: 27251291
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)