Structure of PDB 8wyi Chain n Binding Site BS01

Receptor Information
>8wyi Chain n (length=35) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLR
Ligand information
>8wyi Chain b (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDPKLCYLLDGILFIYGVILTALFLRVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wyi Structures of human gamma delta T cell receptor-CD3 complex.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		T277 A281
Binding residue
(residue number reindexed from 1)		T7 A11
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0036094 small molecule binding
Biological Process
GO:0002250 adaptive immune response
GO:0046629 gamma-delta T cell activation
GO:0050852 T cell receptor signaling pathway
Cellular Component
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0042101 T cell receptor complex
GO:0042106 gamma-delta T cell receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wyi, PDBe:8wyi, PDBj:8wyi
PDBsum8wyi
PubMed38657677
UniProtP0CF51|TRGC1_HUMAN T cell receptor gamma constant 1 (Gene Name=TRGC1);
Q99603

[Back to BioLiP]