Structure of PDB 4pjo Chain n Binding Site BS01

Receptor Information
>4pjo Chain n (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDP
RDAPPPTR
Ligand information
>4pjo Chain 4 (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacuuaccuggcagugaggugcacacacugcauaauuugugguagugg
...........<<<<<<.........>>>>>>.................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pjo ?
Resolution3.3 Å
Binding residue
(original residue number in PDB)		H34 N35 Q36 Y38
Binding residue
(residue number reindexed from 1)		H33 N34 Q35 Y37
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4pjo, PDBe:4pjo, PDBj:4pjo
PDBsum4pjo
PubMed25555158
UniProtP08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa (Gene Name=SNRNP70)

[Back to BioLiP]