Structure of PDB 3jqo Chain n Binding Site BS01

Receptor Information
>3jqo Chain n (length=196) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QDNETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIPCGTGTEL
DTTVPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVL
WERIRNDQDGTIVNIDSAGTNSLGSAGIPGQVDAHMWERLRGAIMISLFS
DTGLASEALRSYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
Ligand information
>3jqo Chain C (length=26) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGHKPPPEPDWSNTVPVNKTIPVDTQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jqo Structure of the outer membrane complex of a type IV secretion system
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q298 V299 D300 A301 H302 M303 Y360 Q363
Binding residue
(residue number reindexed from 1)		Q131 V132 D133 A134 H135 M136 Y170 Q173
Enzymatic activity
Enzyme Commision number ?
External links