Structure of PDB 3jb9 Chain n Binding Site BS01

Receptor Information

>3jb9 Chain n (length=73) Species: 284812 (Schizosaccharomyces pombe 972h-)

VPVNPKPFLQGLIGKPVLVRLKWGQEYKGTLQSVDSYMNLQLLNAEELVD
GVKTGDLGEILIRCNNVLWVGEV

Ligand information

>3jb9 Chain P (length=111)

auucucucuuugccuuuuggcuuagaucaaguguaguaucuguaucuugu
uuuugguuuuuggaaagccucugggcuaugcuuuccucuugcuauugcac
uacuggcaagc

..................................................
.............<<<<<.<.......>.>>>>>...<<<<<<.......
....>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): K25 W26 Y40 R66 N68
• Binding residue (residue number reindexed from 1): K22 W23 Y37 R63 N65

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000387 spliceosomal snRNP assembly
• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005685 U1 snRNP
• GO:0005686 U2 snRNP
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0034715 pICln-Sm protein complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071013 catalytic step 2 spliceosome
• GO:0071014 post-mRNA release spliceosomal complex
• GO:0120114 Sm-like protein family complex

External links

• PDB: RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
• PDBsum: 3jb9
• PubMed: 26292707
• UniProt: O59734|RUXF_SCHPO Small nuclear ribonucleoprotein F (Gene Name=smf1)