Structure of PDB 8fwg Chain m7 Binding Site BS01

Receptor Information
>8fwg Chain m7 (length=137) Species: 2557550 (Agrobacterium phage Milano) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNFNVGVDFPSFIAWDGEESFPVKVDGFNQFGFTFKTIAALTAATTFNIF
YHEPSDADPCVPGPAIRVPEVPFCDTVLLSEDGLAAVTLPETVTPDSFCA
GTVPCMNGQWISIAPATGSETNAANVQITVTMKGATR
Ligand information
>8fwg Chain a7 (length=28) Species: 2557550 (Agrobacterium phage Milano) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MVKLNCRPLCQAPTASRLVSPPCFICRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fwg Neck and capsid architecture of the robust Agrobacterium phage Milano.
Resolution3.45 Å
Binding residue
(original residue number in PDB)
F28 C60 R137
Binding residue
(residue number reindexed from 1)
F28 C60 R137
Enzymatic activity
Enzyme Commision number ?
External links