Structure of PDB 8wyi Chain m Binding Site BS01

Receptor Information
>8wyi Chain m (length=37) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VHTEKVNMMSLTVLGLRILLLKVAGFNLLMTLRLWSS
Ligand information
>8wyi Chain b (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDPKLCYLLDGILFIYGVILTALFLRVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wyi Structures of human gamma delta T cell receptor-CD3 complex.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		R272 L283 S292
Binding residue
(residue number reindexed from 1)		R17 L28 S37
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8wyi, PDBe:8wyi, PDBj:8wyi
PDBsum8wyi
PubMed38657677
UniProtA0JD36;
B7Z8K6;
P01848|TRAC_HUMAN T cell receptor alpha chain constant (Gene Name=TRAC)

[Back to BioLiP]