Structure of PDB 8j5k Chain m Binding Site BS01

Receptor Information
>8j5k Chain m (length=41) Species: 29205 (Stephanocyclus meneghinianus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQFGAYLAVLLGTFLPALFLVNLFIQTEARKAGKAGGQDS
Ligand information
>8j5k Chain t (length=29) Species: 29205 (Stephanocyclus meneghinianus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MEALVYTFLLIGTLMVIFFAVFFRETPRI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8j5k Structural insights into photosystem II supercomplex and trimeric FCP antennae of a centric diatom Cyclotella meneghiniana.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		V3 Y8
Binding residue
(residue number reindexed from 1)		V2 Y7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j5k, PDBe:8j5k, PDBj:8j5k
PDBsum8j5k
PubMed38071196
UniProtA0A679C2A0

[Back to BioLiP]