Structure of PDB 7oui Chain m Binding Site BS01

Receptor Information
>7oui Chain m (length=32) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEVNILAFIATALFILVPTAFLLIIYVKTVSQ
Ligand information
>7oui Chain t (length=29) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MEALVYTFLLVSTLGIIFFAIFFREPPKI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.
Resolution2.79 Å
Binding residue
(original residue number in PDB)		F8 I15
Binding residue
(residue number reindexed from 1)		F8 I15
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oui, PDBe:7oui, PDBj:7oui
PDBsum7oui
PubMed34330992
UniProtP62109|PSBM_ARATH Photosystem II reaction center protein M (Gene Name=psbM)

[Back to BioLiP]