Structure of PDB 7oi7 Chain m Binding Site BS01

Receptor Information
>7oi7 Chain m (length=45) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMP
Ligand information
>7oi7 Chain B (length=56) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaguguagcuuaaaagcacccaacuuacacuuaggagauucaauugacg
cucuga
<<<<<...<<<....>>>.<<.<<.......>>.>>....<<<..>>>.>
>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oi7 A distinct assembly pathway of the human 39S late pre-mitoribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
R42 H44
Binding residue
(residue number reindexed from 1)
R9 H11
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7oi7, PDBe:7oi7, PDBj:7oi7
PDBsum7oi7
PubMed34315873
UniProtQ7Z7F7|RM55_HUMAN Large ribosomal subunit protein mL55 (Gene Name=MRPL55)

[Back to BioLiP]