Structure of PDB 3jap Chain m Binding Site BS01

Receptor Information
>3jap Chain m (length=90) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETATSNYIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNI
VKDPEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIKIHGF
Ligand information
>3jap Chain 1 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgccguggcgcaguggaagcgcgcaggucucauaaaccugauguccuc
ggaucgaaaccgagcggcgcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jap Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		R29 Q31 Q32 R33 N34 G35 E73 F108
Binding residue
(residue number reindexed from 1)		R11 Q13 Q14 R15 N16 G17 E55 F90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0031369 translation initiation factor binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0006450 regulation of translational fidelity
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0016282 eukaryotic 43S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jap, PDBe:3jap, PDBj:3jap
PDBsum3jap
PubMed26212456
UniProtP32911|SUI1_YEAST Eukaryotic translation initiation factor eIF-1 (Gene Name=SUI1)

[Back to BioLiP]