Structure of PDB 8rjb Chain l Binding Site BS01

Receptor Information
>8rjb Chain l (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
Ligand information
>8rjb Chain B (length=27) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVFGPTGMPGPTPSGTNVGSSGRSPSV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rjb UCSF ChimeraX: Meeting modern challenges in visualization and analysis.
Resolution2.69243 Å
Binding residue
(original residue number in PDB)		Q25 W28 R36 R41
Binding residue
(residue number reindexed from 1)		Q24 W27 R35 R40
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rjb, PDBe:8rjb, PDBj:8rjb
PDBsum8rjb
PubMed38896445
UniProtG1TTN1

[Back to BioLiP]