Structure of PDB 8r55 Chain l Binding Site BS01

Receptor Information
>8r55 Chain l (length=120) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF
Ligand information
>8r55 Chain Y (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa
<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<.......<<.<<<<<...>>>>>.>>.......
>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8r55 B. subtilis MutS2 splits stalled ribosomes into subunits without mRNA cleavage.
Resolution3.57 Å
Binding residue
(original residue number in PDB)		K4 S6 K7 R11 R19 R30 N32 F34 R35 S36 N37 K38 H39 Q43 G50 V51 T52 S55 K61 D70 H103 R105
Binding residue
(residue number reindexed from 1)		K4 S6 K7 R11 R19 R30 N32 F34 R35 S36 N37 K38 H39 Q43 G50 V51 T52 S55 K61 D70 H103 R105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r55, PDBe:8r55, PDBj:8r55
PDBsum8r55
PubMed38177497
UniProtF5HRS9

[Back to BioLiP]