Structure of PDB 8qpp Chain l Binding Site BS01

Receptor Information
>8qpp Chain l (length=120) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF
Ligand information
>8qpp Chain Y (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa
<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<.......<<.<<<<<...>>>>>.>>.......
>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K4 S6 K7 R19 N32 F34 R35 S36 N37 K38 H39 Y41 Q43 V51 T52 S55 K61 D70 L101 H103 G104 R105
Binding residue
(residue number reindexed from 1)		K4 S6 K7 R19 N32 F34 R35 S36 N37 K38 H39 Y41 Q43 V51 T52 S55 K61 D70 L101 H103 G104 R105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qpp, PDBe:8qpp, PDBj:8qpp
PDBsum8qpp
PubMed38177497
UniProtF5HRS9

[Back to BioLiP]