Structure of PDB 7ymi Chain l Binding Site BS01

Receptor Information
>7ymi Chain l (length=36) Species: 329726 (Acaryochloris marina MBIC11017) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPNPNKQPVELNRASLFIGLLLVLVLALLFSSYFFN
Ligand information
>7ymi Chain t (length=28) Species: 329726 (Acaryochloris marina MBIC11017) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MDVIAYVFILACIIGLFFFAVFFREKPT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ymi Structure of a large photosystem II supercomplex from Acaryochloris marina.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
R15 F19 L23 L26 F37
Binding residue
(residue number reindexed from 1)
R13 F17 L21 L24 F35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ymi, PDBe:7ymi, PDBj:7ymi
PDBsum7ymi
PubMed38394197
UniProtB0C6T1|PSBL_ACAM1 Photosystem II reaction center protein L (Gene Name=psbL)

[Back to BioLiP]