Structure of PDB 6zvi Chain l Binding Site BS01

Receptor Information
>6zvi Chain l (length=223) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRA
TRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQA
ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKF
ADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKAL
PDAVTIIEPKEEEPILAPSVKDY
Ligand information
>6zvi Chain f (length=35) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuugacaaauuuuuuuuuuaaacugg
...................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zvi EDF1 coordinates cellular responses to ribosome collisions.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R116 R117 R143
Binding residue
(residue number reindexed from 1)		R114 R115 R141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000056 ribosomal small subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0070651 nonfunctional rRNA decay
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0030688 preribosome, small subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zvi, PDBe:6zvi, PDBj:6zvi
PDBsum6zvi
PubMed32744497
UniProtP05750|RS3_YEAST Small ribosomal subunit protein uS3 (Gene Name=RPS3)

[Back to BioLiP]