Structure of PDB 6gsm Chain l Binding Site BS01

Receptor Information
>6gsm Chain l (length=130) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VGLPYSELLSRFFNILRTPKFRIPPPVCLRDGKKTIFSNIQDIAEKLHRS
PEHLIQYLFAELGTSGSVDGKRLVIKGKFQSKQMENVLRRYILEYVTCKT
CKSINTELKRENRLFFMVCKSCGSTRSVSS
Ligand information
>6gsm Chain 1 (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgccguggcgcaguggaagcgcgcagggcucauaacccugauguccuc
ggaucgaaaccgagcggcgcuacc
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.......<
<<.......>>>..>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gsm Large-scale movement of eIF3 domains during translation initiation modulate start codon selection.
Resolution5.15 Å
Binding residue
(original residue number in PDB)		S204 D206 V212 R253 F255
Binding residue
(residue number reindexed from 1)		S67 D69 V74 R113 F115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003743 translation initiation factor activity
Biological Process
GO:0006413 translational initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6gsm, PDBe:6gsm, PDBj:6gsm
PDBsum6gsm
PubMed34648019
UniProtP09064|IF2B_YEAST Eukaryotic translation initiation factor 2 subunit beta (Gene Name=SUI3)

[Back to BioLiP]