Structure of PDB 3jb9 Chain l Binding Site BS01

Receptor Information
>3jb9 Chain l (length=87) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLEEYEFSAGPLSVLQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVL
ENVKEMWTEKAINKDRFISKMFLRGDGVVLVVRIPSA
Ligand information
>3jb9 Chain P (length=111) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auucucucuuugccuuuuggcuuagaucaaguguaguaucuguaucuugu
uuuugguuuuuggaaagccucugggcuaugcuuuccucuugcuauugcac
uacuggcaagc
..................................................
.............<<<<<.<.......>.>>>>>...<<<<<<.......
....>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R48 R62 H63 N65 R102 D104 G105
Binding residue
(residue number reindexed from 1)		R30 R44 H45 N47 R74 D76 G77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030532 small nuclear ribonucleoprotein complex
GO:0032991 protein-containing complex
GO:0034715 pICln-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
PDBsum3jb9
PubMed26292707
UniProtO14036|SMD2_SCHPO Small nuclear ribonucleoprotein Sm D2 (Gene Name=smd2)

[Back to BioLiP]