Structure of PDB 9evx Chain k Binding Site BS01

Receptor Information
>9evx Chain k (length=37) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Ligand information
>9evx Chain y (length=27) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9evx Cryo-electron microscopy reveals hydrogen positions and water networks in photosystem II
Resolution1.71 Å
Binding residue
(original residue number in PDB)		P20 L21 D23 I28 L35 R46
Binding residue
(residue number reindexed from 1)		P11 L12 D14 I19 L26 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9evx, PDBe:9evx, PDBj:9evx
PDBsum9evx
PubMed38900892
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]