Structure of PDB 7d1t Chain k Binding Site BS01

Receptor Information
>7d1t Chain k (length=37) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Ligand information
>7d1t Chain y (length=27) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7d1t High-resolution cryo-EM structure of photosystem II reveals damage from high-dose electron beams.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		P20 D23 I28 L35 W39
Binding residue
(residue number reindexed from 1)		P11 D14 I19 L26 W30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d1t, PDBe:7d1t, PDBj:7d1t
PDBsum7d1t
PubMed33753866
UniProtP19054|PSBK_THEVL Photosystem II reaction center protein K (Fragment) (Gene Name=psbK)

[Back to BioLiP]