Structure of PDB 7czl Chain k Binding Site BS01

Receptor Information
>7czl Chain k (length=34) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGF
Ligand information
>7czl Chain y (length=29) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7czl Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus .
Resolution3.78 Å
Binding residue
(original residue number in PDB)
D5019 P5020 L5021 W5039 V5043
Binding residue
(residue number reindexed from 1)
D8 P9 L10 W28 V32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7czl, PDBe:7czl, PDBj:7czl
PDBsum7czl
PubMed33495333
UniProtP19054|PSBK_THEVL Photosystem II reaction center protein K (Fragment) (Gene Name=psbK)

[Back to BioLiP]