Structure of PDB 6kif Chain k Binding Site BS01

Receptor Information
>6kif Chain k (length=38) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSGDFAAAFLPTIFVPLVGLGLPAVLMSLLFTYIESEA
Ligand information
>6kif Chain o (length=29) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MTDTQVFVALLLALVPAVLAYRLGTELYR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kif Structural basis for energy and electron transfer of the photosystem I-IsiA-flavodoxin supercomplex.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		A6 A7 L10 F14 Y33
Binding residue
(residue number reindexed from 1)		A6 A7 L10 F14 Y33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kif, PDBe:6kif, PDBj:6kif
PDBsum6kif
PubMed32042157
UniProtP95823

[Back to BioLiP]