Structure of PDB 5zwo Chain k Binding Site BS01

Receptor Information
>5zwo Chain k (length=69) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSTPELKKYMDKKILLNINGSRKVAGILRGYDIFLNVVLDDAMEINNHQL
GLQTVIRGNSIISLEALDA
Ligand information
>5zwo Chain H (length=150) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaucucuuugaguguaguaucuguucuuuucaguguaacaacugaaaug
accuaggcucauacauuuuuuggcacggacgggaagaggagacgucgcga
cccucggagucguucuugacuuggucgcuugauguuucuucuucccguuc
.............................<<<<<<......>>>>>><<<
<<<..>>.>>>>...............<<<<<<<<<<.<<<<<<<<<<<<
.<<...<<<<<<....>>>>>>>>>>>>..>>>>>>>>.>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5zwo Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
Resolution3.9 Å
Binding residue
(original residue number in PDB)		F35 G65
Binding residue
(residue number reindexed from 1)		F34 G58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008150 biological_process
GO:0008380 RNA splicing
GO:0036261 7-methylguanosine cap hypermethylation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0034719 SMN-Sm protein complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071004 U2-type prespliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0097526 spliceosomal tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5zwo, PDBe:5zwo, PDBj:5zwo
PDBsum5zwo
PubMed29794219
UniProtP40204|RUXG_YEAST Small nuclear ribonucleoprotein G (Gene Name=SMX2)

[Back to BioLiP]