Structure of PDB 5mx2 Chain k Binding Site BS01

Receptor Information
>5mx2 Chain k (length=36) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Ligand information
>5mx2 Chain y (length=23) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mx2 Structural insights into the light-driven auto-assembly process of the water-oxidizing Mn4CaO5-cluster in photosystem II.
Resolution2.197 Å
Binding residue
(original residue number in PDB)
L21 L35 W39 V43
Binding residue
(residue number reindexed from 1)
L11 L25 W29 V33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5mx2, PDBe:5mx2, PDBj:5mx2
PDBsum5mx2
PubMed28718766
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]