Structure of PDB 4pjo Chain k Binding Site BS01

Receptor Information
>4pjo Chain k (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPR
DAPPPTR
Ligand information
>4pjo Chain 2 (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacuuaccuggcagugaggugcacacacugcauaauuugugguagug
...........<<<<<<.........>>>>>>................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pjo ?
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K32 H34 N35 Q36 Y38
Binding residue
(residue number reindexed from 1)		K30 H32 N33 Q34 Y36
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4pjo, PDBe:4pjo, PDBj:4pjo
PDBsum4pjo
PubMed25555158
UniProtP08621|RU17_HUMAN U1 small nuclear ribonucleoprotein 70 kDa (Gene Name=SNRNP70)

[Back to BioLiP]