Structure of PDB 3jqo Chain k Binding Site BS01

Receptor Information
>3jqo Chain k (length=196) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETSEGSSALAKNLTPARLKASRAGVMANPSLTVPKGKMIPCGTGTELDTT
VPGQVSCRVSQDVYSADGLVRLIDKGSWVDGQITGGIKDGQARVFVLWER
IRNDQDGTIVNIDSAGTNSLGSAGIPGQVDAHMWERLRGAIMISLFSDTL
TAQLASEALRSYMSIPPTLYDQQGDAVSIFVARDLDFSGVYTLADN
Ligand information
>3jqo Chain p (length=23) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HKPPPEPDWSNTVPVNKTIPVDT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jqo Structure of the outer membrane complex of a type IV secretion system
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q298 D300 Y360
Binding residue
(residue number reindexed from 1)		Q128 D130 Y170
Enzymatic activity
Enzyme Commision number ?
External links