Structure of PDB 3jb9 Chain k Binding Site BS01

Receptor Information
>3jb9 Chain k (length=89) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLYVNNLNDKINKNDLRTALYMLFSTYGTVVDIVALKTPKMRGQAHVVFF
DPSAAAIAMKALKNFIFFGKEMKIQYAHSKSKIIERIVA
Ligand information
>3jb9 Chain P (length=111) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auucucucuuugccuuuuggcuuagaucaaguguaguaucuguaucuugu
uuuugguuuuuggaaagccucugggcuaugcuuuccucuugcuauugcac
uacuggcaagc
..................................................
.............<<<<<.<.......>.>>>>>...<<<<<<.......
....>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jb9 Structure of a yeast spliceosome at 3.6-angstrom resolution
Resolution3.6 Å
Binding residue
(original residue number in PDB)
Y7 N9 N10 D13 K14 K17 V38 A39 L40 K41 K44 M45 R46 Q48 H50 K74 Q79 A81 H82 S83 K84 S85 K86
Binding residue
(residue number reindexed from 1)
Y3 N5 N6 D9 K10 K13 V34 A35 L36 K37 K40 M41 R42 Q44 H46 K70 Q75 A77 H78 S79 K80 S81 K82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0030620 U2 snRNA binding
Biological Process
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0005829 cytosol
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3jb9, PDBe:3jb9, PDBj:3jb9
PDBsum3jb9
PubMed26292707
UniProtQ7LL14|RU2B_SCHPO Probable U2 small nuclear ribonucleoprotein B'' (Gene Name=msl1)

[Back to BioLiP]