Structure of PDB 3jap Chain k Binding Site BS01

Receptor Information
>3jap Chain k (length=396) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QATINIGTIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKI
YKCQEEISPKCQRPGCPGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDA
ALLLIAGNESCPQPQTSEHLAAIEIMKLKHVIILQNKVDLMREESALEHQ
KSILKFIRGTIADGAPIVPISAQLKYNIDAVNEFIVKTIPVPPRDFMISP
RLIVIRSFDVNKPGAEIEDLKGGVAGGSILNGVFKLGDEIEIRPGIVTIQ
CKPIFSNIVSLFAEQNDLKFAVPGGLIGVGTKVDPTLCRADRLVGQVVGA
KGHLPNIYTDIEINYFLLRRLLGVKKQAKVRKLEPNEVLMVNIGSTATGA
RVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKK
Ligand information
>3jap Chain 1 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgccguggcgcaguggaagcgcgcaggucucauaaaccugauguccuc
ggaucgaaaccgagcggcgcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jap Conformational Differences between Open and Closed States of the Eukaryotic Translation Initiation Complex.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		F128 K129 K139 F321 V323 P326 F381 R408 A409
Binding residue
(residue number reindexed from 1)		F31 K32 K42 F208 V210 P213 F262 R289 A290
Enzymatic activity
Catalytic site (original residue number in PDB) K113 S114 T137 H197
Catalytic site (residue number reindexed from 1) K16 S17 T40 H84
Enzyme Commision number 3.6.5.3: protein-synthesizing GTPase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003743 translation initiation factor activity
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0031369 translation initiation factor binding
GO:1990856 methionyl-initiator methionine tRNA binding
Biological Process
GO:0001731 formation of translation preinitiation complex
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0045903 positive regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005850 eukaryotic translation initiation factor 2 complex
GO:0016282 eukaryotic 43S preinitiation complex
GO:0033290 eukaryotic 48S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jap, PDBe:3jap, PDBj:3jap
PDBsum3jap
PubMed26212456
UniProtP32481|IF2G_YEAST Eukaryotic translation initiation factor 2 subunit gamma (Gene Name=GCD11)

[Back to BioLiP]