Structure of PDB 3a0h Chain k Binding Site BS01

Receptor Information
>3a0h Chain k (length=36) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPEAYAIFDPLVDVLPVIPVLFFALAFVVQAAVGF
Ligand information
>3a0h Chain y (length=28) Species: 32053 (Thermostichus vulcanus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IAQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3a0h Location of chloride and its possible functions in oxygen-evolving photosystem II revealed by X-ray crystallography
Resolution4.0 Å
Binding residue
(original residue number in PDB)		P5020 L5021 D5023 V5024 L5035
Binding residue
(residue number reindexed from 1)		P11 L12 D14 V15 L26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3a0h, PDBe:3a0h, PDBj:3a0h
PDBsum3a0h
PubMed19433803
UniProtP19054|PSBK_THEVL Photosystem II reaction center protein K (Fragment) (Gene Name=psbK)

[Back to BioLiP]