Structure of PDB 4yuu Chain j2 Binding Site BS01

Receptor Information
>4yuu Chain j2 (length=33) Species: 2771 (Cyanidium caldarium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPLWLVVTFGGIVVLTVLGIFIYGSYSGLGSSL
Ligand information
>4yuu Chain f2 (length=29) Species: 2771 (Cyanidium caldarium) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FTFRWLAIHGLAIPTVFFFGAITAMQFIQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Resolution2.77 Å
Binding residue
(original residue number in PDB)		V24 I27 F28 G31 G35 L36
Binding residue
(residue number reindexed from 1)		V17 I20 F21 G24 G28 L29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yuu, PDBe:4yuu, PDBj:4yuu
PDBsum4yuu
PubMed26757821
UniProtQ9TM23|PSBJ_CYACA Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]