Structure of PDB 4yuu Chain j1 Binding Site BS01

Receptor Information
>4yuu Chain j1 (length=32) Species: 2771 (Cyanidium caldarium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLWLVVTFGGIVVLTVLGIFIYGSYSGLGSSL
Ligand information
>4yuu Chain f1 (length=29) Species: 2771 (Cyanidium caldarium) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TFRWLAIHGLAIPTVFFFGAITAMQFIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Resolution2.77 Å
Binding residue
(original residue number in PDB)		I27 F28 L36 L40
Binding residue
(residue number reindexed from 1)		I19 F20 L28 L32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yuu, PDBe:4yuu, PDBj:4yuu
PDBsum4yuu
PubMed26757821
UniProtQ9TM23|PSBJ_CYACA Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]