Structure of PDB 8xr6 Chain j Binding Site BS01

Receptor Information
>8xr6 Chain j (length=34) Species: 173977 (Chroomonas placoidea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIPLWLIATVGGTLALTVVGIFFYGSYSGVGSSL
Ligand information
>8xr6 Chain f (length=29) Species: 173977 (Chroomonas placoidea) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TFRWLAIHGLAVPTVFFLGAITSMQFIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xr6 Cryo-EM structure of cryptophyte photosystem II
Resolution2.53 Å
Binding residue
(original residue number in PDB)		F27 G30 G34
Binding residue
(residue number reindexed from 1)		F22 G25 G29
Gene Ontology
Cellular Component
GO:0009523 photosystem II
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8xr6, PDBe:8xr6, PDBj:8xr6
PDBsum8xr6
PubMed
UniProtA0A222AI54

[Back to BioLiP]