Structure of PDB 8fru Chain j Binding Site BS01

Receptor Information
>8fru Chain j (length=88) Species: 941442 (Giardia intestinalis assemblage A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASKGTASFGKRHTRIHGSCRRCGKHSFHLQKHECASCGYPSAKMRRYNWS
YKSLRRRTQGTGSMSHMRKVYRAYNSGTLKANARKYLA
Ligand information
>8fru Chain 4 (length=141) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacgccccgccggcggaugccucggcccgggcggcgacgaagagcgcggc
ggagcgcgagacgcggugcggacccgcccgccccgagaagcaccggcccu
cgaacgcagcgcgccccggcgccgccgccucggugcccugc
.........................................<<<<<<.((
.....>>>.....<<<<<<...<..))..>.........>>>>>>...>>
>....<<...>><<....>>.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fru The Giardia lamblia ribosome structure reveals divergence in several biological pathways and the mode of emetine function.
Resolution2.49 Å
Binding residue
(original residue number in PDB)		R31 R32 C33 Q70 G71 G73 M75 H77 M78 Y82 Y85 S87
Binding residue
(residue number reindexed from 1)		R20 R21 C22 Q59 G60 G62 M64 H66 M67 Y71 Y74 S76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fru, PDBe:8fru, PDBj:8fru
PDBsum8fru
PubMed38242118
UniProtV6TG99

[Back to BioLiP]