Structure of PDB 7dco Chain j Binding Site BS01

Receptor Information
>7dco Chain j (length=70) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVNPKPFLKGLVNHRVGVKLKSTEYRGTLVSTDNYFNLQLNEAEEFVAGV
SHGTLGEIFIRCNNVLYIRE
Ligand information
>7dco Chain H (length=169) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuuu
caguguaacaacugaaaugaccuaggcucauacauuuuuuggcacggacg
ggaagaggagacgucgcgacccucggagucguucuugacuuggucgcuug
auguuucuucuucccguuc
................................................<<
<<<<......>>>>>><<<<<<..>>.>>>>...............<<<<
<<<<<<...<<<<<<<<<<.<<...<<<<<<....>>>>>>>>>>>>..>
>>>>>...>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7dco Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K32 Y48 R74
Binding residue
(residue number reindexed from 1)		K21 Y35 R61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 12:49:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7dco', asym_id = 'j', bs = 'BS01', title = 'Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7dco', asym_id='j', bs='BS01', title='Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000387,0000398,0003723,0005681', uniprot = '', pdbid = '7dco', asym_id = 'j'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000387,0000398,0003723,0005681', uniprot='', pdbid='7dco', asym_id='j')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>