Structure of PDB 7b0y Chain j Binding Site BS01

Receptor Information
>7b0y Chain j (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKN
SKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTG
Ligand information
>7b0y Chain a (length=164) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auacuuaccuggcaggggagauaccaugaucacgaaggugguuuucccag
ggcgaggcuuauccauugcacuccggaugugcugaccccugcgauuuccc
caaaugugggaaacucgacugcauaauuugugguagugggggacugcguu
cgcgcuuuccccug
...........<<<<.<<<<<.<<<<<..........>>>>>>>>>>..<
<<...<<<.<<<<<..........>>>>>.>>>...>>>..<<<<<<<<<
.......>>>>>>.>>>.>>>>...............<<<<<<..<<<<.
.>>>>..>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b0y Structure of a transcribing RNA polymerase II-U1 snRNP complex.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Q22 K36 H37 N39 P53 K54 S56 R73 E75
Binding residue
(residue number reindexed from 1)		Q17 K31 H32 N34 P48 K49 S51 R68 E70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0071208 histone pre-mRNA DCP binding
GO:1990446 U1 snRNP binding
GO:1990447 U2 snRNP binding
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005737 cytoplasm
GO:0071204 histone pre-mRNA 3'end processing complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7b0y, PDBe:7b0y, PDBj:7b0y
PDBsum7b0y
PubMed33446560
UniProtQ66K91

[Back to BioLiP]