Structure of PDB 6z3m Chain j Binding Site BS01

Receptor Information
>6z3m Chain j (length=158) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSYLFCGLFGPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGS
SATATNKITIIFKAHHGCTDQKVYQAVTDDLPAAFVDGTTSGGDSDAKSL
RIVEYVEMHARYIGTTVFVRQVGRYLTLAIRMPEDLAMSYEESQDLQLCV
NGCPLSER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z3m Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
Resolution5.501 Å
Binding residue
(original residue number in PDB)		G225 C226 R274 Y275 G277 P296 D298 L299
Binding residue
(residue number reindexed from 1)		G67 C68 R111 Y112 G114 P133 D135 L136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0015026 coreceptor activity
GO:0042802 identical protein binding
Biological Process
GO:0007155 cell adhesion
GO:0007165 signal transduction
GO:0030509 BMP signaling pathway
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005793 endoplasmic reticulum-Golgi intermediate compartment
GO:0005886 plasma membrane
GO:0045121 membrane raft
GO:0098552 side of membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z3m, PDBe:6z3m, PDBj:6z3m
PDBsum6z3m
PubMed32576689
UniProtQ6NW40|RGMB_HUMAN Repulsive guidance molecule B (Gene Name=RGMB)

[Back to BioLiP]